APOBEC3G polyclonal antibody
  • APOBEC3G polyclonal antibody

APOBEC3G polyclonal antibody

Ref: AB-PAB30317
APOBEC3G polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human APOBEC3G.
Información adicional
Size 100 uL
Gene Name APOBEC3G
Gene Alias ARP9|CEM15|FLJ12740|MDS019|bK150C2.7|dJ494G10.1
Gene Description apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTFVDHQGCPFQPWDGLDEHSQDLSGRL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human APOBEC3G.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 60489
Iso type IgG

Enviar un mensaje


APOBEC3G polyclonal antibody

APOBEC3G polyclonal antibody