CD53 polyclonal antibody
  • CD53 polyclonal antibody

CD53 polyclonal antibody

Ref: AB-PAB30307
CD53 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CD53.
Información adicional
Size 100 uL
Gene Name CD53
Gene Alias MOX44|TSPAN25
Gene Description CD53 molecule
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHS
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50 - 1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 111-180 of human CD53.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 963
Iso type IgG

Enviar un mensaje


CD53 polyclonal antibody

CD53 polyclonal antibody