GP9 polyclonal antibody
  • GP9 polyclonal antibody

GP9 polyclonal antibody

Ref: AB-PAB30303
GP9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human GP9.
Información adicional
Size 100 uL
Gene Name GP9
Gene Alias CD42a|GPIX
Gene Description glycoprotein IX (platelet)
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HGLTALPALPARTRHLLLANNSLQSVPPGAFDHLPQLQTLDVTQNPWHCDC
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 41-91 of human GP9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 2815
Iso type IgG

Enviar un mensaje


GP9 polyclonal antibody

GP9 polyclonal antibody