ENPP1 polyclonal antibody
  • ENPP1 polyclonal antibody

ENPP1 polyclonal antibody

Ref: AB-PAB30301
ENPP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ENPP1.
Información adicional
Size 100 uL
Gene Name ENPP1
Gene Alias M6S1|NPP1|NPPS|PC-1|PCA1|PDNP1
Gene Description ectonucleotide pyrophosphatase/phosphodiesterase 1
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq GLKPSCAKEVKSCKGRCFERTFGNCRCDAACVELGNCCLDYQETCIEPEHIWTC
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20 - 1:50)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 96-149 of human ENPP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5167
Iso type IgG

Enviar un mensaje


ENPP1 polyclonal antibody

ENPP1 polyclonal antibody