IL2RA polyclonal antibody
  • IL2RA polyclonal antibody

IL2RA polyclonal antibody

Ref: AB-PAB30287
IL2RA polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human IL2RA.
Información adicional
Size 100 uL
Gene Name IL2RA
Gene Alias CD25|IDDM10|IL2R|TCGFR
Gene Description interleukin 2 receptor, alpha
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq YKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQP
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 41-115 of human IL2RA.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 3559
Iso type IgG

Enviar un mensaje


IL2RA polyclonal antibody

IL2RA polyclonal antibody