SLAMF6 polyclonal antibody
  • SLAMF6 polyclonal antibody

SLAMF6 polyclonal antibody

Ref: AB-PAB30281
SLAMF6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SLAMF6.
Información adicional
Size 100 uL
Gene Name SLAMF6
Gene Alias KALI|KALIb|Ly108|MGC104953|NTB-A|NTBA|SF2000
Gene Description SLAM family member 6
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq TCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDT
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50 - 1:200)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 152-224 of human SLAMF6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 114836
Iso type IgG

Enviar un mensaje


SLAMF6 polyclonal antibody

SLAMF6 polyclonal antibody