CD248 polyclonal antibody
  • CD248 polyclonal antibody

CD248 polyclonal antibody

Ref: AB-PAB30280
CD248 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CD248.
Información adicional
Size 100 uL
Gene Name CD248
Gene Alias CD164L1|MGC119478|MGC119479|TEM1
Gene Description CD248 molecule, endosialin
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq EEDEDEAWKAFNGGWTEMPGILWMEPTQPPDFALAYRPSFPEDREPQIPYPEPTWPPPLSAPRVPYHSSVLSVTRPVVVSATH
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50 - 1:200)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 375-457 of human CD248.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 57124
Iso type IgG

Enviar un mensaje


CD248 polyclonal antibody

CD248 polyclonal antibody