CD69 polyclonal antibody
  • CD69 polyclonal antibody

CD69 polyclonal antibody

Ref: AB-PAB30274
CD69 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CD69.
Información adicional
Size 100 uL
Gene Name CD69
Gene Alias CLEC2C
Gene Description CD69 molecule
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50 - 1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 62-126 of human CD69.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 969
Iso type IgG

Enviar un mensaje


CD69 polyclonal antibody

CD69 polyclonal antibody