CD68 polyclonal antibody
  • CD68 polyclonal antibody

CD68 polyclonal antibody

Ref: AB-PAB30268
CD68 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CD68.
Información adicional
Size 100 uL
Gene Name CD68
Gene Alias DKFZp686M18236|GP110|SCARD1
Gene Description CD68 molecule
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYG
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000 - 1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 150-221 of human CD68.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 968
Iso type IgG

Enviar un mensaje


CD68 polyclonal antibody

CD68 polyclonal antibody