CSF3R polyclonal antibody
  • CSF3R polyclonal antibody

CSF3R polyclonal antibody

Ref: AB-PAB30266
CSF3R polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CSF3R.
Información adicional
Size 100 uL
Gene Name CSF3R
Gene Alias CD114|GCSFR
Gene Description colony stimulating factor 3 receptor (granulocyte)
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TPVVFSESRGPALTRLHAMARDPHSLWVGWEPPNPWPQGYVIEWGLGPPSASNSNKTWRMEQNGRATGFLLKENIRPFQLYEIIVTPLYQDTMGPSQHVYAYSQEMAPSHAPELHLKHIGKTWA
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500 - 1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 420-543 of human CSF3R.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1441
Iso type IgG

Enviar un mensaje


CSF3R polyclonal antibody

CSF3R polyclonal antibody