HMOX1 polyclonal antibody
  • HMOX1 polyclonal antibody

HMOX1 polyclonal antibody

Ref: AB-PAB30262
HMOX1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human HMOX1.
Información adicional
Size 100 uL
Gene Name HMOX1
Gene Alias HO-1|HSP32|bK286B10
Gene Description heme oxygenase (decycling) 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P
Immunogen Prot. Seq QDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAF
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HMOX1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3162
Iso type IgG

Enviar un mensaje


HMOX1 polyclonal antibody

HMOX1 polyclonal antibody