CLU polyclonal antibody
  • CLU polyclonal antibody

CLU polyclonal antibody

Ref: AB-PAB30261
CLU polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human CLU.
Información adicional
Size 100 uL
Gene Name CLU
Gene Alias AAG4|APOJ|CLI|KUB1|MGC24903|SGP-2|SGP2|SP-40|TRPM-2|TRPM2
Gene Description clusterin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P
Immunogen Prot. Seq SSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNS
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CLU.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1191
Iso type IgG

Enviar un mensaje


CLU polyclonal antibody

CLU polyclonal antibody