SOX11 polyclonal antibody
  • SOX11 polyclonal antibody

SOX11 polyclonal antibody

Ref: AB-PAB30260
SOX11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human SOX11.
Información adicional
Size 100 uL
Gene Name SOX11
Gene Alias -
Gene Description SRY (sex determining region Y)-box 11
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKK
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SOX11.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6664
Iso type IgG

Enviar un mensaje


SOX11 polyclonal antibody

SOX11 polyclonal antibody