GPRASP1 polyclonal antibody
  • GPRASP1 polyclonal antibody

GPRASP1 polyclonal antibody

Ref: AB-PAB30251
GPRASP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human GPRASP1.
Información adicional
Size 100 uL
Gene Name GPRASP1
Gene Alias GASP|GASP1|KIAA0443
Gene Description G protein-coupled receptor associated sorting protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VEACVEGDVNSKSSLEDKEEAMIPCFGAKEEVSMKHGTGVRCRFMAGAEETNNKSCFWAEKEPCMYPAGGGSWKSRPEEEEDIVNSWFWSRKYTKPEAIIGSWLWATEESNIDGTGEKAKLLTEE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GPRASP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9737
Iso type IgG

Enviar un mensaje


GPRASP1 polyclonal antibody

GPRASP1 polyclonal antibody