VCL polyclonal antibody
  • VCL polyclonal antibody

VCL polyclonal antibody

Ref: AB-PAB30250
VCL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human VCL.
Información adicional
Size 100 uL
Gene Name VCL
Gene Alias CMD1W|MVCL
Gene Description vinculin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq KMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAWASKDTEAMKRALASIDSKLNQAKGWLRDPSASPGDAGEQAIRQILDEAGKVGELCAGKERREI
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human VCL.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7414
Iso type IgG

Enviar un mensaje


VCL polyclonal antibody

VCL polyclonal antibody