SERPINA1 polyclonal antibody
  • SERPINA1 polyclonal antibody

SERPINA1 polyclonal antibody

Ref: AB-PAB30249
SERPINA1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human SERPINA1.
Información adicional
Size 100 uL
Gene Name SERPINA1
Gene Alias A1A|A1AT|AAT|MGC23330|MGC9222|PI|PI1|PRO2275
Gene Description serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq HDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYGAPHR
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:2500-1:5000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SERPINA1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5265
Iso type IgG

Enviar un mensaje


SERPINA1 polyclonal antibody

SERPINA1 polyclonal antibody