BRD1 polyclonal antibody
  • BRD1 polyclonal antibody

BRD1 polyclonal antibody

Ref: AB-PAB30247
BRD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human BRD1.
Información adicional
Size 100 uL
Gene Name BRD1
Gene Alias BRL|BRPF1|BRPF2|DKFZp686F0325
Gene Description bromodomain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LKREQVKVEQVAMELRLTPLTVLLRSVLDQLQDKDPARIFAQPVSLKEVPDYLDHIKHPMDFATMRKRLEAQGYKNLHEFEEDFDLIIDNCMKYNARDTVFYRAAVRLRDQGGVV
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BRD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23774
Iso type IgG

Enviar un mensaje


BRD1 polyclonal antibody

BRD1 polyclonal antibody