BID polyclonal antibody
  • BID polyclonal antibody

BID polyclonal antibody

Ref: AB-PAB30245
BID polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human BID.
Información adicional
Size 100 uL
Gene Name BID
Gene Alias FP497|MGC15319|MGC42355
Gene Description BH3 interacting domain death agonist
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq VNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLAR
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BID.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 637
Iso type IgG

Enviar un mensaje


BID polyclonal antibody

BID polyclonal antibody