NPC1 polyclonal antibody
  • NPC1 polyclonal antibody

NPC1 polyclonal antibody

Ref: AB-PAB30241
NPC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human NPC1.
Información adicional
Size 100 uL
Gene Name NPC1
Gene Alias NPC
Gene Description Niemann-Pick disease, type C1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VLNKVDIGLDQSLSMPDDSYMVDYFKSISQYLHAGPPVYFVLEEGHDYTSSKGQNMVCGGMGCNNDSLVQQIFNAAQLDNYTRIGFAPSSWIDDYFDWVKPQSSCCRVDNITDQFCNASVVD
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NPC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4864
Iso type IgG

Enviar un mensaje


NPC1 polyclonal antibody

NPC1 polyclonal antibody