ATG7 polyclonal antibody
  • ATG7 polyclonal antibody

ATG7 polyclonal antibody

Ref: AB-PAB30240
ATG7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human ATG7.
Información adicional
Size 100 uL
Gene Name ATG7
Gene Alias APG7-LIKE|APG7L|DKFZp434N0735|GSA7
Gene Description ATG7 autophagy related 7 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq EAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTADKKLLLEQAANEIWESIKSGTALENPVLLNKFLLLTFADLKKYHFYYWFCYPALCLPESLPLIQGPVGLDQRFSLKQIEAL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ATG7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10533
Iso type IgG

Enviar un mensaje


ATG7 polyclonal antibody

ATG7 polyclonal antibody