ATG4C polyclonal antibody
  • ATG4C polyclonal antibody

ATG4C polyclonal antibody

Ref: AB-PAB30239
ATG4C polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human ATG4C.
Información adicional
Size 100 uL
Gene Name ATG4C
Gene Alias APG4-C|APG4C|AUTL1|AUTL3|FLJ14867
Gene Description ATG4 autophagy related 4 homolog C (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq EEARHPDLQGITIYVAQDCTVYNSDVIDKQSASMTSDNADDKAVIILVPVRLGGERTNTDYLEFVKGILSLEYCVGIIGGKPKQSYYFAGFQDDSLIYMDPHYCQSFV
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ATG4C.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84938
Iso type IgG

Enviar un mensaje


ATG4C polyclonal antibody

ATG4C polyclonal antibody