INS polyclonal antibody
  • INS polyclonal antibody

INS polyclonal antibody

Ref: AB-PAB30238
INS polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human INS.
Información adicional
Size 100 uL
Gene Name INS
Gene Alias ILPR|IRDN
Gene Description insulin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq SHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYC
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:2500-1:5000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human INS.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3630
Iso type IgG

Enviar un mensaje


INS polyclonal antibody

INS polyclonal antibody