GNPTG polyclonal antibody
  • GNPTG polyclonal antibody

GNPTG polyclonal antibody

Ref: AB-PAB30236
GNPTG polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human GNPTG.
Información adicional
Size 100 uL
Gene Name GNPTG
Gene Alias C16orf27|GNPTAG|LP2537|RJD9
Gene Description N-acetylglucosamine-1-phosphate transferase, gamma subunit
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq PHALLVYPTLPEALQRQWDQVEQDLADELITPQGHEKLLRTLFEDAGYLKTPEENEPTQLEGGPDSLGFETLENCRKAHKELSKEIKRLKGLLTQHGIPYTRPTETSNLEHLG
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GNPTG.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84572
Iso type IgG

Enviar un mensaje


GNPTG polyclonal antibody

GNPTG polyclonal antibody