SLC25A21 polyclonal antibody
  • SLC25A21 polyclonal antibody

SLC25A21 polyclonal antibody

Ref: AB-PAB30234
SLC25A21 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human SLC25A21.
Información adicional
Size 100 uL
Gene Name SLC25A21
Gene Alias MGC126570|ODC|ODC1
Gene Description solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq PEVSLVREASRQIVAGGSAGLVEICLMHPLDVVKTRFQIQRCATDPNSYKSLVDSFRMIFQMEGLFGFYKGILPPILAETPKRAVKFFTFEQYKKLLGYVSLSPALTFAIAGLGSGLTEAIVVNPFEVVKVGL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC25A21.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 89874
Iso type IgG

Enviar un mensaje


SLC25A21 polyclonal antibody

SLC25A21 polyclonal antibody