CD14 polyclonal antibody
  • CD14 polyclonal antibody

CD14 polyclonal antibody

Ref: AB-PAB30223
CD14 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CD14.
Información adicional
Size 100 uL
Gene Name CD14
Gene Alias -
Gene Description CD14 molecule
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq PCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500 - 1:1000)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 24 - 147 of human CD14.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 929
Iso type IgG

Enviar un mensaje


CD14 polyclonal antibody

CD14 polyclonal antibody