ODF2 polyclonal antibody
  • ODF2 polyclonal antibody

ODF2 polyclonal antibody

Ref: AB-PAB30222
ODF2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ODF2.
Información adicional
Size 100 uL
Gene Name ODF2
Gene Alias FLJ44866|MGC111096|MGC9034|ODF2/1|ODF2/2|ODF84
Gene Description outer dense fiber of sperm tails 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq HKRGMKGDTVNVRRSVRVKTKNPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500 - 1:1000)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 44 - 205 of human ODF2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4957
Iso type IgG

Enviar un mensaje


ODF2 polyclonal antibody

ODF2 polyclonal antibody