FBLN1 polyclonal antibody
  • FBLN1 polyclonal antibody

FBLN1 polyclonal antibody

Ref: AB-PAB30219
FBLN1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human FBLN1.
Información adicional
Size 100 uL
Gene Name FBLN1
Gene Alias FBLN
Gene Description fibulin 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq CESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQDALGNCIDINECLSISAPCPIGHTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDECAPPAEPCGKGHRCVNSPGSFRCECKTGYYFDGISRMCVDVNE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
Western Blot (1:250 - 1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 266 - 402 of human FBLN1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 2192
Iso type IgG

Enviar un mensaje


FBLN1 polyclonal antibody

FBLN1 polyclonal antibody