CDH13 polyclonal antibody
  • CDH13 polyclonal antibody

CDH13 polyclonal antibody

Ref: AB-PAB30218
CDH13 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CDH13.
Información adicional
Size 100 uL
Gene Name CDH13
Gene Alias CDHH
Gene Description cadherin 13, H-cadherin (heart)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq GTGTLLITLEDVNDNAPFIYPTVAEVCDDAKNLSVVILGASDKDLHPNTDPFKFEIHKQAVPDKVWKISKINNTHALVSLLQNLNKANYNLPIMVTDSGKPPMTNITDLRVQVCSCRNSKVDCNAAGALRFSLPSVLLLSLFSLA
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50 - 1:200)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 567 - 711 of human CDH13.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1012
Iso type IgG

Enviar un mensaje


CDH13 polyclonal antibody

CDH13 polyclonal antibody