MAGEB1 polyclonal antibody
  • MAGEB1 polyclonal antibody

MAGEB1 polyclonal antibody

Ref: AB-PAB30216
MAGEB1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MAGEB1.
Información adicional
Size 100 uL
Gene Name MAGEB1
Gene Alias DAM10|MAGE-Xp|MAGEL1|MGC9322
Gene Description melanoma antigen family B, 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq FMNVLGAYDGEEHLIYGEPRKFITQDLVQEKYLKYEQVPNSDPPRYQFLWGPRAYAETTKMKVLEFLAKMNGATPRDFPSHYEEALRDEEERAQVRSSVRARRRTTATTFRARSRAPFSRSS
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50 - 1:200)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 223 - 344 of human MAGEB1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4112
Iso type IgG

Enviar un mensaje


MAGEB1 polyclonal antibody

MAGEB1 polyclonal antibody