C1orf149 polyclonal antibody
  • C1orf149 polyclonal antibody

C1orf149 polyclonal antibody

Ref: AB-PAB30163
C1orf149 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human C1orf149.
Información adicional
Size 100 uL
Gene Name C1orf149
Gene Alias CDABP0189|Eaf6|FLJ11730|NY-SAR-91
Gene Description chromosome 1 open reading frame 149
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq HNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQM
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.2-1 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human C1orf149.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 64769

Enviar un mensaje


C1orf149 polyclonal antibody

C1orf149 polyclonal antibody