KCNH6 polyclonal antibody
  • KCNH6 polyclonal antibody

KCNH6 polyclonal antibody

Ref: AB-PAB30161
KCNH6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human KCNH6.
Información adicional
Size 100 uL
Gene Name KCNH6
Gene Alias ERG2|HERG2|Kv11.2
Gene Description potassium voltage-gated channel, subfamily H (eag-related), member 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq GKYRTISQIPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEK
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (1.25 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human KCNH6.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 81033

Enviar un mensaje


KCNH6 polyclonal antibody

KCNH6 polyclonal antibody