ILF2 polyclonal antibody
  • ILF2 polyclonal antibody

ILF2 polyclonal antibody

Ref: AB-PAB30157
ILF2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human ILF2.
Información adicional
Size 100 uL
Gene Name ILF2
Gene Alias MGC8391|NF45|PRO3063
Gene Description interleukin enhancer binding factor 2, 45kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq HGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEKPPEKKEGEEEEE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to C-terminus of human ILF2.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 3608

Enviar un mensaje


ILF2 polyclonal antibody

ILF2 polyclonal antibody