HOXC10 polyclonal antibody
  • HOXC10 polyclonal antibody

HOXC10 polyclonal antibody

Ref: AB-PAB30144
HOXC10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human HOXC10.
Información adicional
Size 100 uL
Gene Name HOXC10
Gene Alias HOX3I|MGC5259
Gene Description homeobox C10
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq MTCPRNVTPNSYAEPLAAPGGGERYSRSAGMYMQSGSDFNCGVMRGCGLA
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.0625 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human HOXC10.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 3226

Enviar un mensaje


HOXC10 polyclonal antibody

HOXC10 polyclonal antibody