HNRNPH3 polyclonal antibody
  • HNRNPH3 polyclonal antibody

HNRNPH3 polyclonal antibody

Ref: AB-PAB30138
HNRNPH3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human HNRNPH3.
Información adicional
Size 100 uL
Gene Name HNRNPH3
Gene Alias 2H9|FLJ34092|HNRPH3
Gene Description heterogeneous nuclear ribonucleoprotein H3 (2H9)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq DYQGRSTGEAFVQFASKEIAENALGKHKERIGHRYIEIFRSSRSEIKGFY
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (1 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human HNRNPH3.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 3189

Enviar un mensaje


HNRNPH3 polyclonal antibody

HNRNPH3 polyclonal antibody