HMGB3 polyclonal antibody
  • HMGB3 polyclonal antibody

HMGB3 polyclonal antibody

Ref: AB-PAB30133
HMGB3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human HMGB3.
Información adicional
Size 100 uL
Gene Name HMGB3
Gene Alias HMG2A|HMG4|MGC90319
Gene Description high-mobility group box 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P
Immunogen Prot. Seq NLNDSEKQPYITKAAKLKEKYEKDVADYKSKGKFDGAKGPAKVARKKVEE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.3 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to C-terminus of human HMGB3.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 3149

Enviar un mensaje


HMGB3 polyclonal antibody

HMGB3 polyclonal antibody