HCLS1 polyclonal antibody
  • HCLS1 polyclonal antibody

HCLS1 polyclonal antibody

Ref: AB-PAB30129
HCLS1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human HCLS1.
Información adicional
Size 100 uL
Gene Name HCLS1
Gene Alias CTTNL|HS1
Gene Description hematopoietic cell-specific Lyn substrate 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq VNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGP
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (1.25 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human HCLS1.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 3059

Enviar un mensaje


HCLS1 polyclonal antibody

HCLS1 polyclonal antibody