HAL polyclonal antibody
  • HAL polyclonal antibody

HAL polyclonal antibody

Ref: AB-PAB30126
HAL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human HAL.
Información adicional
Size 100 uL
Gene Name HAL
Gene Alias HIS|HSTD
Gene Description histidine ammonia-lyase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P
Immunogen Prot. Seq EAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTK
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (1.25 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to C-terminus of human HAL.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 3034

Enviar un mensaje


HAL polyclonal antibody

HAL polyclonal antibody