GTF2I polyclonal antibody
  • GTF2I polyclonal antibody

GTF2I polyclonal antibody

Ref: AB-PAB30119
GTF2I polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human GTF2I.
Información adicional
Size 100 uL
Gene Name GTF2I
Gene Alias BAP-135|BAP135|BTKAP1|DIWS|FLJ38776|FLJ56355|IB291|SPIN|TFII-I|WBS|WBSCR6
Gene Description general transcription factor II, i
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq ILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVKEESEDPDYYQYNIQGSH
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.2-1 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human GTF2I.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 2969

Enviar un mensaje


GTF2I polyclonal antibody

GTF2I polyclonal antibody