AB-PAB30119
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Size | 100 uL |
Gene Name | GTF2I |
Gene Alias | BAP-135|BAP135|BTKAP1|DIWS|FLJ38776|FLJ56355|IB291|SPIN|TFII-I|WBS|WBSCR6 |
Gene Description | general transcription factor II, i |
Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Application Key | WB-Ce,IHC-P |
Immunogen Prot. Seq | ILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVKEESEDPDYYQYNIQGSH |
Form | Liquid |
Recomended Dilution | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)<br>Western Blot (0.2-1 ug/mL)<br>The optimal working dilution should be determined by the end user. |
Antigen species Target species | Human |
Immunogen | A synthetic peptide corresponding to N-terminus of human GTF2I. |
Storage Buffer | In PBS (2% sucrose, 0.09% sodium azide). |
Gene ID | 2969 |