GTF2I polyclonal antibody Ver mas grande

GTF2I polyclonal antibody

AB-PAB30119

Producto nuevo

GTF2I polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name GTF2I
Gene Alias BAP-135|BAP135|BTKAP1|DIWS|FLJ38776|FLJ56355|IB291|SPIN|TFII-I|WBS|WBSCR6
Gene Description general transcription factor II, i
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq ILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVKEESEDPDYYQYNIQGSH
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)<br>Western Blot (0.2-1 ug/mL)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human GTF2I.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 2969

Más información

Rabbit polyclonal antibody raised against synthetic peptide of human GTF2I.

Consulta sobre un producto

GTF2I polyclonal antibody

GTF2I polyclonal antibody