GPAA1 polyclonal antibody
  • GPAA1 polyclonal antibody

GPAA1 polyclonal antibody

Ref: AB-PAB30107
GPAA1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human GPAA1.
Información adicional
Size 100 uL
Gene Name GPAA1
Gene Alias GAA1|hGAA1
Gene Description glycosylphosphatidylinositol anchor attachment protein 1 homolog (yeast)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq LGSLFLWRELQEAPLSLAEGWQLFLAALAQGVLEHHTYGALLFPLLSLGL
Form Liquid
Recomended Dilution Immunofluorescence (1:100)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.2-1 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to C-terminus of human GPAA1.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 8733

Enviar un mensaje


GPAA1 polyclonal antibody

GPAA1 polyclonal antibody