GMPPB polyclonal antibody
  • GMPPB polyclonal antibody

GMPPB polyclonal antibody

Ref: AB-PAB30104
GMPPB polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human GMPPB.
Información adicional
Size 100 uL
Gene Name GMPPB
Gene Alias KIAA1851
Gene Description GDP-mannose pyrophosphorylase B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq RCRVGQWVRMENVTVLGEDVIVNDELYLNGASVLPHKSIGESVPEPRIIM
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (5 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to C-terminus of human GMPPB.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 29925

Enviar un mensaje


GMPPB polyclonal antibody

GMPPB polyclonal antibody