GGTLC1 polyclonal antibody
  • GGTLC1 polyclonal antibody

GGTLC1 polyclonal antibody

Ref: AB-PAB30102
GGTLC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human GGTLC1.
Información adicional
Size 100 uL
Gene Name GGTLC1
Gene Alias GGTL6|GGTLA3|GGTLA4|MGC50550|dJ831C21.1|dJ831C21.2
Gene Description gamma-glutamyltransferase light chain 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P
Immunogen Prot. Seq DQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (5 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to C-terminus of human GGTLC1.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 92086

Enviar un mensaje


GGTLC1 polyclonal antibody

GGTLC1 polyclonal antibody