Ver mas grande
GATA2 polyclonal antibody
AB-PAB30096
Producto nuevo
GATA2 polyclonal antibody
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | GATA2 |
| Gene Alias | MGC2306|NFE1B |
| Gene Description | GATA binding protein 2 |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB,IHC-P |
| Immunogen Prot. Seq | PYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSA |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)<br>Western Blot<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | A synthetic peptide corresponding to N-terminus of human GATA2. |
| Storage Buffer | In PBS (2% sucrose, 0.09% sodium azide). |
| Gene ID | 2624 |
Más información
Rabbit polyclonal antibody raised against synthetic peptide of human GATA2.