GATA2 polyclonal antibody
  • GATA2 polyclonal antibody

GATA2 polyclonal antibody

Ref: AB-PAB30096
GATA2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human GATA2.
Información adicional
Size 100 uL
Gene Name GATA2
Gene Alias MGC2306|NFE1B
Gene Description GATA binding protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq PYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSA
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human GATA2.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 2624

Enviar un mensaje


GATA2 polyclonal antibody

GATA2 polyclonal antibody