GAPVD1 polyclonal antibody
  • GAPVD1 polyclonal antibody

GAPVD1 polyclonal antibody

Ref: AB-PAB30094
GAPVD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human GAPVD1.
Información adicional
Size 100 uL
Gene Name GAPVD1
Gene Alias DKFZp434C212|GAPEX5|KIAA1521|MGC138847|MGC138848|RAP6
Gene Description GTPase activating protein and VPS9 domains 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq FKLFSEGLFSAKLFLTATLHEPIMQLLVEDEDHLETDPNKLIERFSPSQQ
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.25 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human GAPVD1.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 26130

Enviar un mensaje


GAPVD1 polyclonal antibody

GAPVD1 polyclonal antibody