FOXA3 polyclonal antibody
  • FOXA3 polyclonal antibody

FOXA3 polyclonal antibody

Ref: AB-PAB30081
FOXA3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human FOXA3.
Información adicional
Size 100 uL
Gene Name FOXA3
Gene Alias FKHH3|HNF3G|MGC10179|TCF3G
Gene Description forkhead box A3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq FENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSP
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.2-1 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to internal region of human FOXA3.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 3171

Enviar un mensaje


FOXA3 polyclonal antibody

FOXA3 polyclonal antibody