FKTN polyclonal antibody
  • FKTN polyclonal antibody

FKTN polyclonal antibody

Ref: AB-PAB30079
FKTN polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human FKTN.
Información adicional
Size 100 uL
Gene Name FKTN
Gene Alias CMD1X|FCMD|LGMD2M|MGC126857|MGC134944|MGC134945|MGC138243
Gene Description fukutin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq TAFALQYHLWKNEEGWFRIAENMGFQCLKIESKDPRLDGIDSLSGTEIPL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (5 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human FKTN.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 2218

Enviar un mensaje


FKTN polyclonal antibody

FKTN polyclonal antibody