FAM174B polyclonal antibody
  • FAM174B polyclonal antibody

FAM174B polyclonal antibody

Ref: AB-PAB30067
FAM174B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human FAM174B.
Información adicional
Size 100 uL
Gene Name FAM174B
Gene Alias MGC102891
Gene Description family with sequence similarity 174, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq FTTLLIACLLLRVFRSGKRLKKTRKYDIITTPAERVEMAPLNEEDDEDED
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (1.25 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to C-terminus of human FAM174B.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 400451

Enviar un mensaje


FAM174B polyclonal antibody

FAM174B polyclonal antibody