FAM134B polyclonal antibody
  • FAM134B polyclonal antibody

FAM134B polyclonal antibody

Ref: AB-PAB30065
FAM134B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human FAM134B.
Información adicional
Size 100 uL
Gene Name FAM134B
Gene Alias FLJ20152|FLJ22155|FLJ22179
Gene Description family with sequence similarity 134, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq LSVSDTDVSEVSWTDNGTFNLSEGYTPQTDTSDDLDRPSEEVFSRDLSDF
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.625 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to internal region of human FAM134B.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 54463

Enviar un mensaje


FAM134B polyclonal antibody

FAM134B polyclonal antibody