EXOSC6 polyclonal antibody
  • EXOSC6 polyclonal antibody

EXOSC6 polyclonal antibody

Ref: AB-PAB30060
EXOSC6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human EXOSC6.
Información adicional
Size 100 uL
Gene Name EXOSC6
Gene Alias EAP4|MTR3|Mtr3p|hMtr3p|p11
Gene Description exosome component 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq MPGDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAK
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (5 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human EXOSC6.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 118460

Enviar un mensaje


EXOSC6 polyclonal antibody

EXOSC6 polyclonal antibody