Ver mas grande
EXOSC4 polyclonal antibody
AB-PAB30059
Producto nuevo
EXOSC4 polyclonal antibody
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | EXOSC4 |
| Gene Alias | FLJ20591|RRP41|RRP41A|Rrp41p|SKI6|Ski6p|hRrp41p|p12A |
| Gene Description | exosome component 4 |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,IHC-P |
| Immunogen Prot. Seq | SDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHE |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)<br>Western Blot (5 ug/mL)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | A synthetic peptide corresponding to N-terminus of human EXOSC4. |
| Storage Buffer | In PBS (2% sucrose, 0.09% sodium azide). |
| Gene ID | 54512 |
Más información
Rabbit polyclonal antibody raised against synthetic peptide of human EXOSC4.