EXOSC10 polyclonal antibody
  • EXOSC10 polyclonal antibody

EXOSC10 polyclonal antibody

Ref: AB-PAB30056
EXOSC10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human EXOSC10.
Información adicional
Size 100 uL
Gene Name EXOSC10
Gene Alias PM-Scl|PM/Scl-100|PMSCL|PMSCL2|RRP6|Rrp6p|p2|p3|p4
Gene Description exosome component 10
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq FAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRG
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (5 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to C-terminus of human EXOSC10.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 5394

Enviar un mensaje


EXOSC10 polyclonal antibody

EXOSC10 polyclonal antibody